LL-37 from AurumLabs is a research-grade human cathelicidin antimicrobial peptide in lyophilised form. Each vial contains LL-37 for in-vitro laboratory research only. Certificates of Analysis are published on our Certificates page as they become available.
Storage
Keep the sealed vial refrigerated at 2–8°C.
LL-37 5mg specifications
| Compound type | Human cathelicidin antimicrobial peptide (37 amino acids) |
|---|---|
| Sequence | [LL-37, 37 aa] |
| CAS number | 154947-66-7 |
| Molecular formula | C205H340N60O53 |
| Molecular weight (g/mol) | 4493.3 |
| Vial sizes | 5mg |
| Form | Lyophilised powder, sealed vial |
| Storage | 2-8C sealed, or -20C long term, away from light |
| Documentation | Batch Certificate of Analysis (view certificates) |
| Intended use | In-vitro laboratory research only. Not for human or animal use. |
LL-37 5mg questions
How should LL-37 5mg be stored?
Keep the sealed lyophilised vial refrigerated at 2-8C, or frozen at -20C for storage over several months, protected from light.
Is LL-37 5mg for human use?
No. AurumLabs supplies LL-37 5mg for in-vitro laboratory research only. It is not a medicine or supplement and is not for human or animal consumption.
